FOXS1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14732
Additional Names:: FKHL18|FOXS1|FREAC10
Application:: ELISA, WB
Molecular Weight:: 33kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Uniprot:: O43638
Synonyms:: FKHL18;forkhead box protein S1;forkhead-like 18 protein;forkhead-related activator 10;forkhead-related transcription factor 10;forkhead-related transcription factor FREAC-10;FREAC-10;FREAC10
Extra Details:: The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown.