A14731
FGF4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14731
- Additional Names:
- FGF-4|FGF4|HBGF-4|HST|HST-1|HSTF-1|HSTF1|K-FGF|KFGF
- Application:
- ELISA, WB
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
- Uniprot:
- P08620
- Synonyms:
- FGF-4;fibroblast growth factor 4;HBGF-4;heparin secretory transforming protein 1;Heparin secretory-transforming protein 1;heparin-binding growth factor 4;HST;HST-1;HSTF-1;HSTF1;human stomach cancer, transforming factor from FGF-related oncogene;K-FGF;kaposi sarcoma oncogene;KFGF;oncogene HST;transforming protein KS3
- Extra Details:
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway.
- Shipping Conditions:
- Blue Ice

