A14723
DAD1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14723
- Additional Names:
- DAD1|OST2
- Application:
- ELISA, WB
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA
- Uniprot:
- P61803
- Synonyms:
- DAD-1;Defender against cell death 1;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1;oligosaccharyl transferase subunit DAD1;oligosaccharyltransferase 2 homolog;oligosaccharyltransferase subunit 2 (non-catalytic);OST2
- Extra Details:
- DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
- Shipping Conditions:
- Blue Ice