A14722
Casein Kinase 2 beta (CSNK2B) Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14722
- Additional Names:
- Casein Kinase 2 beta (CSNK2B)|CK2B|CK2N|Ckb1|Ckb2|CSK2B|G5A|POBINDS
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
- Uniprot:
- P67870
- Synonyms:
- alternative name: G5a, phosvitin;casein kinase 2, beta polypeptide;Casein kinase II beta subunit;casein kinase II subunit beta;CK II beta;CK2B;CK2N;Ckb1;Ckb2;CSK2B;CSNK2B-LY6G5B-1072;CSNK2B-LY6G5B-1103;CSNK2B-LY6G5B-532;CSNK2B-LY6G5B-560;CSNK2B-LY6G5B-562;G5A;phosvitin;POBINDS;protein G5a
- Extra Details:
- This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice





