A14718
CCR7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14718
- Additional Names:
- BLR2|CC-CKR-7|CCR-7|CCR7|CD197|CDw197|CMKBR7|EBI1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAET
- Uniprot:
- P32248
- Synonyms:
- BLR2;Bukitt's lymphoma receptor 2;C-C chemokine receptor type 7;CC chemokine receptor 7;CC-CKR-7;CCR-7;CD197;CDw197;chemokine (C-C motif) receptor 7;CMKBR7;EBI1;EBV-induced G protein-coupled receptor 1;Epstein-Barr virus induced gene 1;Epstein-Barr virus-induced G-protein coupled receptor 1;lymphocyte-specific G protein-coupled peptide receptor;MIP-3 beta receptor
- Extra Details:
- The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice