CACNB3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14710
Additional Names:: CAB3|CACNB3|CACNLB3
Application:: ELISA, WB
Molecular Weight:: 58kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY
Uniprot:: P54284
Synonyms:: CAB3;CACNLB3;Calcium channel voltage-dependent subunit beta 3;calcium channel, voltage-dependent, beta 3 subunit;voltage-dependent L-type calcium channel subunit beta-3
Extra Details:: This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport.