A14685
FIP200 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14685
- Additional Names:
- ATG17|CC1|FIP200|PPP1R131
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 225kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPS
- Uniprot:
- Q8TDY2
- Synonyms:
- 200 kDa FAK family kinase-interacting protein;ATG17;CC1;FAK family kinase-interacting protein of 200 kDa;FIP200;phosphatase 1, regulatory subunit 131;PPP1R131;RB1-inducible coiled-coil protein 1
- Extra Details:
- The protein encoded by this gene interacts with signaling pathways to coordinately regulate cell growth, cell proliferation, apoptosis, autophagy, and cell migration. This tumor suppressor also enhances retinoblastoma 1 gene expression in cancer cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice