GLI1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14675
Additional Names:: GLI|GLI1|PAPA8|PPD1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 150 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSL
Uniprot:: P08151
Synonyms:: GLI;GLI-Kruppel family member GLI1;Glioma-associated oncogene;glioma-associated oncogene 1;glioma-associated oncogene homolog 1 (zinc finger protein);oncogene GLI;PAPA8;PPD1;zinc finger protein GLI1
Extra Details:: This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene.