LOXL2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14638
Additional Names:: LOR|LOR2|LOXL2|WS9-14
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ANVAKIQLRLAGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVT
Uniprot:: Q9Y4K0
Synonyms:: LOR;LOR2;lysyl oxidase homolog 2;lysyl oxidase related 2;lysyl oxidase-like 2 delta e13;lysyl oxidase-like 2 protein;lysyl oxidase-like protein 2;lysyl oxidase-related protein 2;lysyl oxidase-related protein WS9-14;WS9-14
Extra Details:: This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Shipping Conditions:: Blue Ice