A14629
MEAF6 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14629
- Additional Names:
- C1orf149|CENP-28|EAF6|MEAF6|NY-SAR-91
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY
- Uniprot:
- Q9HAF1
- Synonyms:
- C1orf149;CENP-28;centromere protein 28;chromatin modification-related protein MEAF6;EAF6;Esa1-associated factor 6 homolog;Esa1p-associated factor 6 homolog;NY-SAR-91;protein EAF6 homolog;sarcoma antigen NY-SAR-91
- Extra Details:
- This gene encodes a nuclear protein involved in transcriptional activation. The encoded protein may form a component of several different histone acetyltransferase complexes. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice