A14609
Pro-glucagon Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14609
- Additional Names:
- GLP-1|GLP1|GLP2|GRPP|Pro-glucagon
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 21kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
- Uniprot:
- P01275
- Synonyms:
- glicentin-related polypeptide;GLP-1;GLP1;GLP2;glucagon-like peptide 1;glucagon-like peptide 2;GRPP;preproglucagon;pro-glucagon
- Extra Details:
- The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
- Shipping Conditions:
- Blue Ice