A14605
RYBP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14605
- Additional Names:
- AAP1|APAP-1|DEDAF|RYBP|YEAF1
- Application:
- ELISA, WB
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
- Uniprot:
- Q8N488
- Synonyms:
- AAP1;APAP-1;apoptin-associating protein 1;death effector domain-associated factor;DED-associated factor;DEDAF;RING1 and YY1-binding protein;ring1 interactor RYBP;YEAF1;YY1 and E4TF1 associated factor 1;YY1 and E4TF1-associated factor 1
- Extra Details:
- Predicted to enable DNA binding activity and transcription coregulator activity. Involved in several processes, including histone H2A monoubiquitination; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; and positive regulation of transcription, DNA-templated. Located in nucleoplasm. Colocalizes with PcG protein complex.
- Shipping Conditions:
- Blue Ice