A1460
Butyrylcholinesterase Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1460
- Additional Names:
- BCHED|Butyrylcholinesterase|CHE1|CHE2|E1
- Application:
- ELISA, WB
- Molecular Weight:
- 68kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNR
- Uniprot:
- P06276
- Synonyms:
- acylcholine acylhydrolase;BCHED;butyrylcholine esterase;CHE1;CHE2;choline esterase II;cholinesterase;cholinesterase (serum) 2;cholinesterase 1;E1;pseudocholinesterase
- Extra Details:
- This gene encodes a cholinesterase enzyme and member of the type-B carboxylesterase/lipase family of proteins. The encoded enzyme exhibits broad substrate specificity and is involved in the detoxification of poisons including organophosphate nerve agents and pesticides, and the metabolism of drugs including cocaine, heroin and aspirin. Humans homozygous for certain mutations in this gene exhibit prolonged apnea after administration of the muscle relaxant succinylcholine.
- Shipping Conditions:
- Blue Ice