SLC26A2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14561
Additional Names:: D5S1708|DTD|DTDST|EDM4|MST153|MSTP157|SLC26A2
Application:: ELISA, WB
Molecular Weight:: 82kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGD
Uniprot:: P50443
Synonyms:: D5S1708;diastrophic dysplasia protein;DTD;DTDST;EDM4;MST153;MSTP157;solute carrier family 26 (anion exchanger), member 2;solute carrier family 26 (sulfate transporter), member 2;Solute carrier family 26 member 2;sulfate anion transporter 1;sulfate transporter
Extra Details:: The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization.