SLC47A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14559
Additional Names:: MATE1|SLC47A1
Application:: ELISA, WB
Molecular Weight:: 62kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL
Uniprot:: Q96FL8
Synonyms:: hMATE-1;MATE-1;MATE1;multidrug and toxin extrusion 1;multidrug and toxin extrusion protein 1;solute carrier family 47 (multidrug and toxin extrusion), member 1;Solute carrier family 47 member 1
Extra Details:: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.