TOMM22 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14548
Additional Names:: 1C9-2|MST065|MSTP065|TOM22|TOMM22
Application:: ELISA, WB
Molecular Weight:: 16kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Uniprot:: Q9NS69
Synonyms:: 1C9-2;mitochondrial import receptor subunit TOM22 homolog;mitochondrial import receptor Tom22;MST065;MSTP065;TOM22;translocase of outer membrane 22 kDa subunit homolog;translocase of outer mitochondrial membrane 22 homolog
Extra Details:: The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.