A14545
PDP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14545
- Additional Names:
- PDH|PDP|PDP1|PDPC|PPM2A|PPM2C
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 61kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFL
- Uniprot:
- Q9P0J1
- Synonyms:
- [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial;PDH;PDP;PDP 1;PDPC;PDPC 1;PPM2A;PPM2C;Protein phosphatase 2C;protein phosphatase 2C, magnesium-dependent, catalytic subunit;protein phosphatase, Mg2+/Mn2+ dependent 2A;pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase;Pyruvate dehydrogenase phosphatase catalytic subunit 1;pyruvate dehyrogenase phosphatase catalytic subunit 1
- Extra Details:
- Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2C (PP2C) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice



