A14519
NLRP12 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14519
- Additional Names:
- CLR19.3|FCAS2|NALP12|NLRP12|PAN6|PYPAF7|RNO|RNO2
- Application:
- ELISA, WB
- Molecular Weight:
- 120kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC
- Uniprot:
- P59046
- Synonyms:
- CLR19.3;FCAS2;monarch 1;Monarch-1;NACHT, LRR and PYD domains-containing protein 12;NALP12;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 12;PAN6;PYPAF7;PYRIN-containing APAF1-like protein 7;regulated by nitric oxide;RNO;RNO2
- Extra Details:
- This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice