SMYD3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14516
Additional Names:: bA74P14.1|KMT3E|SMYD3|ZMYND1|ZNFN3A1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
Uniprot:: Q9H7B4
Synonyms:: bA74P14.1;histone-lysine N-methyltransferase SMYD3;KMT3E;SET and MYND domain-containing protein 3;zinc finger MYND domain-containing protein 1;zinc finger protein, subfamily 3A (MYND domain containing), 1;zinc finger, MYND domain containing 1;ZMYND1;ZNFN3A1
Extra Details:: This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.