A14513
ZAK Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14513
- Additional Names:
- AZK|CNM6|MLK7|mlklak|MLT|MLTK|MLTKalpha|MLTKbeta|MRK|pk|SFMMP|ZAK
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 105kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERE
- Synonyms:
- AZK;CNM6;HCCS-4;human cervical cancer suppressor gene 4 protein;mitogen-activated protein kinase kinase kinase 20;mitogen-activated protein kinase kinase kinase MLT;mixed lineage kinase 7;mixed lineage kinase with a leucine zipper and a sterile alpha motif;mixed lineage kinase-related kinase MRK-beta;MLK-like mitogen-activated protein triple kinase;MLK7;mlklak;MLT;MLTK;MLTKalpha;MLTKbeta;MRK;pk;SFMMP;sterile alpha motif and leucine zipper containing kinase AZK;ZAK;ZAK1 homolog, leucine zipper and sterile-alpha motif kinase
- Extra Details:
- This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Shipping Conditions:
- Blue Ice



