A14509
NGDN Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14509
- Additional Names:
- C14orf120|CANu1|LCP5|lpd-2|NGD|NGDN
- Application:
- ELISA, WB
- Molecular Weight:
- Refer to Figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
- Uniprot:
- Q8NEJ9
- Synonyms:
- C14orf120;CANu1;centromere accumulated nuclear protein 1;EIF4E-binding protein;eukaryotic initiation factor 4E and CPEB binding protein;LCP5;lpd-2;neuroguidin;neuroguidin, EIF4E binding protein;NGD
- Extra Details:
- Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).
- Shipping Conditions:
- Blue Ice

