PRAME Rabbit polyclonal antibody

Size

£152.00

SKU:: A14507
Additional Names:: CT130|MAPE|OIP-4|OIP4|PRAME
Application:: ELISA, WB
Molecular Weight:: 58kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVK
Uniprot:: P78395
Synonyms:: cancer/testis antigen 130;CT130;MAPE;melanoma antigen preferentially expressed in tumors;OIP-4;OIP4;opa-interacting protein 4;Opa-interacting protein OIP4;preferentially expressed antigen in melanoma;preferentially expressed antigen of melanoma
Extra Details:: This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants.