A14500
RBX1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14500
- Additional Names:
- BA554C12.1|RBX1|RNF75|ROC1
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
- Uniprot:
- P62877
- Synonyms:
- BA554C12.1;E3 ubiquitin-protein ligase RBX1;E3 ubiquitin-protein transferase RBX1;Protein ZYP;regulator of cullins 1;RING finger protein 75;ring-box 1, E3 ubiquitin protein ligase;RING-box protein 1;RNF75;ROC1;ZYP protein
- Extra Details:
- This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
- Shipping Conditions:
- Blue Ice