A14497
CDK5R1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14497
- Additional Names:
- CDK5P35|CDK5R|CDK5R1|NCK5A|p23|p25|p35|p35nck5a
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
- Uniprot:
- Q15078
- Synonyms:
- CDK5 activator 1;CDK5P35;CDK5R;cyclin-dependent kinase 5 activator 1;Cyclin-dependent kinase 5 regulatory subunit 1;NCK5A;neuronal CDK5 activator;p23;p25;p35;p35nck5a;regulatory partner for CDK5 kinase;tau protein kinase II 23kDa subunit;TPKII regulatory subunit
- Extra Details:
- The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.
- Shipping Conditions:
- Blue Ice



