A14496
DYNLL1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14496
- Additional Names:
- DLC1|DLC8|DNCL1|DNCLC1|DYNLL1|hdlc1|LC8|LC8a|PIN
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
- Uniprot:
- P63167
- Synonyms:
- 8 kDa dynein light chain;cytoplasmic dynein light polypeptide;DLC1;DLC8;DNCL1;DNCLC1;dynein light chain 1, cytoplasmic;Dynein light chain LC8-type 1;dynein, cytoplasmic, light polypeptide 1;hdlc1;LC8;LC8a;PIN;protein inhibitor of neuronal nitric oxide synthase
- Extra Details:
- Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.
- Shipping Conditions:
- Blue Ice








