A1447
CNR1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1447
- Additional Names:
- CANN6|CB-R|CB1|CB1A|CB1K5|CB1R|CNR|CNR1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
- Uniprot:
- P21554
- Synonyms:
- CANN6;cannabinoid receptor 1;cannabinoid receptor 1 (brain);CB-R;CB1;CB1A;CB1K5;CB1R;central cannabinoid receptor;CNR
- Extra Details:
- This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice





