PSD2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14429
Additional Names:: EFA6C|PSD2
Application:: ELISA, WB
Molecular Weight:: 85kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARD
Uniprot:: Q9BQI7
Synonyms:: EFA6C;exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C;exchange factor for ARF6 C;PH and SEC7 domain-containing protein 2;pleckstrin homology and SEC7 domain-containing protein 2
Extra Details:: Predicted to enable guanyl-nucleotide exchange factor activity and phospholipid binding activity. Predicted to be involved in regulation of ARF protein signal transduction and regulation of catalytic activity. Predicted to be located in cleavage furrow and ruffle membrane. Predicted to be active in glutamatergic synapse and postsynapse.