A14410
G2E3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14410
- Additional Names:
- G2E3|KIAA1333|PHF7B
- Application:
- ELISA, WB
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI
- Uniprot:
- Q7L622
- Synonyms:
- G2/M phase-specific E3 ubiquitin-protein ligase;G2/M phase-specific HECT-type E3 ubiquitin transferase;G2/M-phase specific E3 ubiquitin ligase;KIAA1333;PHD finger protein 7B;PHF7B
- Extra Details:
- Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in apoptotic process and protein ubiquitination. Predicted to act upstream of or within blastocyst development; negative regulation of intrinsic apoptotic signaling pathway; and protein polyubiquitination. Located in Golgi apparatus and cytosol.
- Shipping Conditions:
- Blue Ice