A1438
FTO Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1438
- Additional Names:
- ALKBH9|BMIQ14|FTO|GDFD
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- STGTLDYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK
- Uniprot:
- Q9C0B1
- Synonyms:
- AlkB homolog 9;ALKBH9;alpha-ketoglutarate-dependent dioxygenase FTO;BMIQ14;fat mass and obesity associated;fat mass and obesity-associated protein;GDFD;m6A(m)-demethylase FTO;mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO;mRNA N(6)-methyladenosine demethylase FTO;tRNA N1-methyl adenine demethylase FTO;U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO;U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO
- Extra Details:
- This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes.
- Shipping Conditions:
- Blue Ice



