KCNJ12 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14375
Additional Names:: hIRK|hIRK1|hkir2.2x|IRK-2|IRK2|KCNJ12|kcnj12x|KCNJN1|Kir2.2
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Uniprot:: Q14500
Synonyms:: ATP-sensitive inward rectifier potassium channel 12;hIRK;hIRK1;hkir2.2x;Inward rectifier K(+) channel Kir2.2;inward rectifier K(+) channel Kir2.2v;inward rectifier K(+) channel Kir2.6;IRK-2;IRK2;kcnj12x;KCNJN1;Kir2.2;Kir2.2v;Potassium channel, inwardly rectifying subfamily J member 12;potassium channel, inwardly rectifying subfamily J, member 12;potassium inwardly-rectifying channel, subfamily J, inhibitor 1;potassium voltage-gated channel subfamily J member 12
Extra Details:: This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17.