TMEM25 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14370
Additional Names:: TMEM25
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: APGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL
Uniprot:: Q86YD3
Synonyms:: 0610039J01Rik;transmembrane protein 25
Extra Details:: Predicted to be involved in negative regulation of excitatory postsynaptic potential and regulation of protein stability. Predicted to be located in late endosome and lysosome.