A14310
TRMT112 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14310
- Additional Names:
- HSPC152|HSPC170|hTrm112|TRM112|TRMT11-2|TRMT112
- Application:
- ELISA, WB
- Molecular Weight:
- 14kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
- Uniprot:
- Q9UI30
- Synonyms:
- HSPC152;HSPC170;hTrm112;multifunctional methyltransferase subunit TRM112-like protein;TRM112;TRM112-like protein;TRMT11-2;tRNA methyltransferase 11-2 homolog;tRNA methyltransferase 112 homolog;tRNA methyltransferase subunit 11-2
- Extra Details:
- Enables protein heterodimerization activity and protein methyltransferase activity. Involved in macromolecule methylation and positive regulation of rRNA processing. Located in nucleoplasm and perinuclear region of cytoplasm. Part of protein-containing complex.
- Shipping Conditions:
- Blue Ice