A14245
FOXK2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14245
- Additional Names:
- FOXK2|ILF|ILF-1|ILF1|nGTBP
- Application:
- ELISA, WB
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSPL
- Uniprot:
- Q01167
- Synonyms:
- cellular transcription factor ILF-1;forkhead box protein K2;FOXK1;G/T-mismatch specific binding protein;ILF;ILF-1;ILF1;interleukin enhancer-binding factor 1;nGTBP
- Extra Details:
- The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
- Shipping Conditions:
- Blue Ice