GABRG1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14240
Additional Names:: GABRG1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 54kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIM
Uniprot:: Q8N1C3
Synonyms:: GABA(A) receptor subunit gamma-1;GABA(A) receptor, gamma;gamma-1 polypeptide;gamma-aminobutyric acid (GABA) A receptor, gamma 1;gamma-aminobutyric acid receptor subunit gamma-1;gamma-aminobutyric acid type A receptor gamma1 subunit
Extra Details:: The protein encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4.