A14238
EPHA5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14238
- Additional Names:
- CEK7|EHK-1|EHK1|EK7|EPHA5|HEK7|TYRO4
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 115kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIEL
- Uniprot:
- P54756
- Synonyms:
- brain-specific kinase;CEK7;EHK-1;EHK1;EK7;EPH homology kinase 1;EPH-like kinase 7;ephrin type-A receptor 5;epididymis secretory sperm binding protein;HEK7;receptor protein-tyrosine kinase HEK7;TYRO4;tyrosine-protein kinase receptor EHK-1
- Extra Details:
- This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice