EML2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14218
Additional Names:: ELP70|EMAP-2|EMAP2|EML2
Application:: ELISA, WB
Molecular Weight:: 71kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSR
Uniprot:: O95834
Synonyms:: echinoderm microtubule associated protein like 2;echinoderm microtubule-associated protein-like 2;echinoderm MT-associated protein (EMAP)-like protein 70;ELP70;EMAP-2;EMAP2;microtubule-associated protein like echinoderm EMAP
Extra Details:: Enables microtubule binding activity. Involved in negative regulation of microtubule polymerization and regulation of microtubule nucleation. Colocalizes with mitotic spindle.