A14208
WDR33 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14208
- Additional Names:
- 1110001N06Rik|2310011G05Rik|2810021O11Rik|8430413N20Rik|WDC146|WDR33
- Application:
- ELISA, WB
- Molecular Weight:
- 145kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREA
- Synonyms:
- 1110001N06Rik;2310011G05Rik;2810021O11Rik;8430413N20Rik;NET14;pre-mRNA 3' end processing protein WDR33;WD repeat-containing protein 33;WD repeat-containing protein of 146 kDa;WD repeat-containing protein WDC146;WDC146
- Extra Details:
- Predicted to be involved in mRNA polyadenylation. Predicted to act upstream of or within mRNA processing. Located in nucleus. Orthologous to human WDR33 (WD repeat domain 33).
- Shipping Conditions:
- Blue Ice