A14196
WNK1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14196
- Additional Names:
- HSAN2|HSN2|KDP|p65|PPP1R167|PRKWNK1|PSK|WNK1
- Application:
- ELISA, WB
- Molecular Weight:
- 300kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETK
- Uniprot:
- Q9H4A3
- Synonyms:
- erythrocyte 65 kDa protein;HSAN2;HSN2;KDP;Kinase deficient protein;p65;PPP1R167;PRKWNK1;prostate-derived sterile 20-like kinase;Protein kinase lysine-deficient 1;protein kinase with no lysine 1;protein phosphatase 1, regulatory subunit 167;PSK;serine/threonine-protein kinase WNK1;serine/threonine-protein kinase WNK1 1;serine/threonine-protein kinase WNK1 2
- Extra Details:
- This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. Alternatively spliced transcript variants encoding different isoforms have been described but the full-length nature of all of them has yet to be determined.
- Shipping Conditions:
- Blue Ice