A14189
NFATC2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14189
- Additional Names:
- JCOSL|NFAT1|NFATC2|NFATP
- Application:
- ELISA, WB
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
- Uniprot:
- Q13469
- Synonyms:
- NF-ATc2;NFAT pre-existing subunit;NFAT transcription complex, preexisting component;NFAT1;NFATP;nuclear factor of activated T-cells, cytoplasmic 2;nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2;nuclear factor of activated T-cells, preexisting component;preexisting nuclear factor of activated T-cells 2;T cell transcription factor NFAT1;T-cell transcription factor NFAT1
- Extra Details:
- This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants encoding different isoforms have been characterized.
- Shipping Conditions:
- Blue Ice