A14188
MYL2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A14188
- Additional Names:
- CMH10|MFM12|MLC-2|MLC-2s/v|MLC-2v|MLC2|MYL2
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
- Uniprot:
- P10916
- Synonyms:
- cardiac myosin light chain 2;cardiac ventricular myosin light chain 2;CMH10;MFM12;MLC-2;MLC-2s/v;MLC-2v;MLC2;Myosin light chain 2, slow skeletal/ventricular muscle isoform;myosin regulatory light chain 2, ventricular/cardiac muscle isoform;myosin, light chain 2, regulatory, cardiac, slow;myosin, light polypeptide 2, regulatory, cardiac, slow;regulatory light chain of myosin;RLC of myosin;slow cardiac myosin regulatory light chain 2;truncated myosin light chain 2;ventricular myosin light chain 2
- Extra Details:
- This gene encodes a major sarcomeric protein in mammalian striated muscle. The encoded protein plays a role in embryonic heart muscle structure and function, while phosphorylation of the encoded protein is involved in cardiac myosin cycling kinetics, torsion and function in adults. Mutations in this gene are associated with hypertrophic cardiomyopathy 10 and infant-onset myopathy.
- Shipping Conditions:
- Blue Ice