A14171
Serotonin transporter Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14171
- Additional Names:
- 5-HTT|5-HTTLPR|5HTT|hSERT|HTT|OCD1|Serotonin transporter|SERT|SERT1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGK
- Uniprot:
- P31645
- Synonyms:
- 5-HTT;5-HTTLPR;5-hydroxytryptamine (serotonin) transporter;5HT transporter;5HTT;hSERT;HTT;Na+/Cl- dependent serotonin transporter;OCD1;serotonin transporter 1;SERT;SERT1;sodium-dependent serotonin transporter;solute carrier family 6 (neurotransmitter transporter, serotonin), member 4;solute carrier family 6 (neurotransmitter transporter), member 4;Solute carrier family 6 member 4
- Extra Details:
- This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
