CISD2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14168
Additional Names:: CISD2|ERIS|Miner1|NAF-1|WFS2|ZCD2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 15kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Uniprot:: Q8N5K1
Synonyms:: CDGSH iron-sulfur domain-containing protein 2;endoplasmic reticulum intermembrane small protein;ERIS;Miner1;mitoNEET-related 1 protein;NAF-1;nutrient-deprivation autophagy factor-1;WFS2;ZCD2;zinc finger, CDGSH-type domain 2
Extra Details:: The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2.