TGF beta Receptor II Rabbit polyclonal antibody

Size

£152.00

SKU:: A1415
Additional Names:: AAT3|FAA3|LDS1B|LDS2|LDS2B|MFS2|RIIC|TAAD2|tbetaR-II|TBR-ii|TBRII|TGF beta Receptor II (TGFBR2)|TGFbeta-RII|TGFR-2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 70 kDa/85 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP
Uniprot:: P37173
Synonyms:: AAT3;FAA3;LDS1B;LDS2;LDS2B;MFS2;RIIC;TAAD2;tbetaR-II;TBR-ii;TBRII;TGF-beta receptor type IIB;TGF-beta receptor type-2;TGF-beta type II receptor;TGFbeta-RII;TGFR-2;transforming growth factor beta receptor II;transforming growth factor beta receptor type IIC;Transforming growth factor-beta receptor type II;transforming growth factor, beta receptor II (70/80kDa);transforming growth factor, beta receptor II alpha;transforming growth factor, beta receptor II beta;transforming growth factor, beta receptor II delta;transforming growth factor, beta receptor II epsilon;transforming growth factor, beta receptor II gamma
Extra Details:: The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.

Shipping Conditions:: Blue Ice