NOP58 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14129
Additional Names:: HSPC120|NOP5|NOP5/NOP58|NOP58
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
Uniprot:: Q9Y2X3
Synonyms:: HSPC120;NOP5;NOP5/NOP58;NOP58 ribonucleoprotein homolog;nucleolar protein 5;nucleolar protein 58;nucleolar protein NOP5/NOP58
Extra Details:: The protein encoded by this gene is a core component of box C/D small nucleolar ribonucleoproteins. Some box C/D small nucleolar RNAs (snoRNAs), such as U3, U8, and U14, are dependent upon the encoded protein for their synthesis. This protein is SUMOylated, which is necessary for high affinity binding to snoRNAs.