A1406
PTPN22 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1406
- Additional Names:
- LYP|LYP1|LYP2|PEP|PTPN22|PTPN22.5|PTPN22.6|PTPN8
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 107kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFI
- Uniprot:
- Q9Y2R2
- Synonyms:
- hematopoietic cell protein-tyrosine phosphatase 70Z-PEP;Lymphoid phosphatase;lymphoid-specific protein tyrosine phosphatase;LYP;LYP1;LYP2;PEP;PEST-domain phosphatase;protein tyrosine phosphatase, non-receptor type 22 (lymphoid);protein tyrosine phosphatase, non-receptor type 8;PTPN22.5;PTPN22.6;PTPN8;tyrosine-protein phosphatase non-receptor type 22
- Extra Details:
- This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
- Shipping Conditions:
- Blue Ice