A14050
PPA1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14050
- Additional Names:
- HEL-S-66p|IOPPP|PP|PP1|PPA1|SID6-8061
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
- Uniprot:
- Q15181
- Synonyms:
- cytosolic inorganic pyrophosphatase;diphosphate phosphohydrolase;epididymis secretory sperm binding protein Li 66p;HEL-S-66p;inorganic diphosphatase 1;inorganic pyrophosphatase;IOPPP;PP;PP1;PPase;pyrophosphatase (inorganic) 1;pyrophosphatase 1;pyrophosphate phospho-hydrolase;SID6-8061
- Extra Details:
- The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.
- Shipping Conditions:
- Blue Ice

