PMS1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A14046
Additional Names:: HNPCC3|hPMS1|MLH2|PMS1|PMSL1
Application:: ELISA, WB
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLK
Uniprot:: P54277
Synonyms:: DNA mismatch repair protein PMS1;HNPCC3;hPMS1;human homolog of yeast mutL;mismatch repair gene PMSL1;MLH2;PMS1 postmeiotic segregation increased 1;PMS1 protein homolog 1;PMSL1;rhabdomyosarcoma antigen MU-RMS-40.10B;rhabdomyosarcoma antigen MU-RMS-40.10E
Extra Details:: This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome.