S1PR3 Rabbit monoclonal antibody

Size

POA

SKU:: A1404
Additional Names:: bA791O21.3|C9orf108|C9orf47|EDG-3|EDG3|LPB3|S1P3|S1PR3
Application:: ELISA, WB
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSG
Uniprot:: Q99500
Synonyms:: bA791O21.3;C9orf108;C9orf47;EDG-3;EDG3;endothelial differentiation G-protein coupled receptor 3;endothelial differentiation, sphingolipid G-protein-coupled receptor, 3;G protein-coupled receptor, endothelial differentiation gene-3;LPB3;S1P receptor 3;S1P receptor Edg-3;S1P receptor EDG3;S1P3;sphingosine 1-phosphate receptor 3;sphingosine 1-phosphate receptor Edg-3;uncharacterized protein C9orf47
Extra Details:: This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function.