A14026
MRE11 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A14026
- Additional Names:
- ATLD|HNGS1|MRE11|MRE11A|MRE11B
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 81kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFL
- Uniprot:
- P49959
- Synonyms:
- AT-like disease;ATLD;DNA recombination and repair protein;double-strand break repair protein MRE11;double-strand break repair protein MRE11A;endo/exonuclease Mre11;HNGS1;meiotic recombination 11 homolog 1;meiotic recombination 11 homolog A;MRE11 double strand break repair nuclease A;MRE11 homolog 1;MRE11 homolog A, double strand break repair nuclease;MRE11 homolog, double strand break repair nuclease A;MRE11 meiotic recombination 11 homolog A;MRE11 meiotic recombination 11-like protein A;MRE11A;MRE11B
- Extra Details:
- This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice



