A13970
DAZL Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13970
- Additional Names:
- DAZH|DAZL|DAZL1|DAZLA|SPGYLA
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR
- Uniprot:
- Q92904
- Synonyms:
- DAZ homolog;DAZ-like autosomal;DAZH;DAZL1;DAZLA;deleted in azoospermia-like;deleted in azoospermia-like 1;germline specific RNA binding protein;spermatogenesis gene on the Y-like autosomal;SPGY-like-autosomal;SPGYLA;testis secretory sperm-binding protein Li 204a
- Extra Details:
- The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice